Thermo Fisher Scientific PYY Polyclonal Antibody
Thermo Fisher Scientific의 PYY Polyclonal Antibody는 Mouse 및 Rat 시료에 반응하며 Western Blot과 IHC(Paraffin)에 적합합니다. Rabbit IgG 기반의 비결합 항체로, 항원 친화 크로마토그래피로 정제되었습니다. 식욕 조절 관련 PYY 단백질 연구에 활용됩니다.
- 카탈로그번호
- PA579900
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PYY Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29–64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747015 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Peptide tyrosine-tyrosine amide (3–36), or PYY (3–36), is a major metabolite of the gut hormone PYY. It is produced by the action of dipeptidyl peptidase IV on PYY in the intestinal brush border and in circulation.
PYY (3–36) acts as a potent inhibitor of food intake in rats and humans by selectively activating the Y2 receptor, which inhibits orexigenic NPY neurons in the arcuate nucleus and disinhibits anorexigenic POMC neurons.
The anorexigenic effect of PYY (3–36) is additive to that of the co-secreted gut hormone GLP-1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음, OCR 텍스트만 통합 완료)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.