Thermo Fisher Scientific PYY Polyclonal Antibody
Thermo Fisher Scientific의 PYY Polyclonal Antibody는 Mouse 및 Rat 시료에 반응하며 Western Blot과 IHC(Paraffin)에 적합합니다. Rabbit IgG 기반의 비결합 항체로, 항원 친화 크로마토그래피로 정제되었습니다. 식욕 조절 관련 PYY 단백질 연구에 활용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29–64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747015 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Peptide tyrosine-tyrosine amide (3–36), or PYY (3–36), is a major metabolite of the gut hormone PYY. It is produced by the action of dipeptidyl peptidase IV on PYY in the intestinal brush border and in circulation.
PYY (3–36) acts as a potent inhibitor of food intake in rats and humans by selectively activating the Y2 receptor, which inhibits orexigenic NPY neurons in the arcuate nucleus and disinhibits anorexigenic POMC neurons.
The anorexigenic effect of PYY (3–36) is additive to that of the co-secreted gut hormone GLP-1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음, OCR 텍스트만 통합 완료)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific RAB13 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RAB10 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PYY Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Paxillin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PTPRF Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|