Thermo Fisher Scientific IL-4 Polyclonal Antibody, Biotin, PeproTech

Thermo Fisher Scientific IL-4 Polyclonal Antibody, Biotin, PeproTech

Applications and Tested Dilution

Product Specifications

Product Specific Information

AA Sequence of recombinant protein:
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human IL-4. Anti-Human IL-4-specific antibody was purified by affinity chromatography and then biotinylated.

Sandwich ELISA:
To detect hIL-4 by sandwich ELISA (using 100 µL/well antibody solution), a concentration of 0.25–1.0 µg/mL of this antibody is required. This biotinylated polyclonal antibody, in conjunction with PeproTech Polyclonal Anti-Human IL-4 (500-P24) as a capture antibody, allows the detection of at least 0.2–0.4 ng/well of Recombinant hIL-4.

Western Blot:
To detect hIL-4 by Western Blot analysis, this antibody can be used at a concentration of 0.1–0.2 µg/mL. Used in conjunction with compatible secondary reagents, the detection limit for Recombinant hIL-4 is 1.5–3.0 ng/lane, under either reducing or non-reducing conditions.

Packaging:
500-P24BT-1MG is provided as 2 × 500 µg.

Target Information

Interleukin-4 (IL-4) is a pleiotropic, immune-modulatory cytokine produced by activated T cells and serves as a ligand for the interleukin-4 receptor. IL-4 exhibits broad biological activity and shares overlapping functions with IL-13 through receptor cross-binding. STAT6 mediates IL-4’s immune regulatory signaling. The IL-4 gene resides within a cytokine cluster on chromosome 5q alongside IL-3, IL-5, IL-13, and CSF2. IL-4, IL-13, and IL-5 are coordinated by long-range regulatory elements spanning approximately 120 kb. IL-4 delta 2 is a known splice variant.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)