Thermo Fisher Scientific IL-4 Polyclonal Antibody, Biotin, PeproTech

Thermo Fisher Scientific IL-4 Polyclonal Antibody, Biotin, PeproTech

상품 한눈에 보기

인간 IL-4에 특이적인 비오틴 표지 폴리클로날 항체로, Western blot 및 ELISA에서 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 고순도 재조합 IL-4로 면역된 토끼 혈청에서 생산. 연구용으로만 사용.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 08. 05. 오전 12:45
소모품
500-P24BT-50UG
Thermo Fisher Scientific 500-P24BT-50UG IL-4 Polyclonal Antibody, Biotin, PeproTech 50 ug pk
CAS: -단위: pk
재고문의재고: -
411,600
(VAT포함)452,760
500-P24BT-25UG
Thermo Fisher Scientific 500-P24BT-25UG IL-4 Polyclonal Antibody, Biotin, PeproTech 25 ug pk
CAS: -단위: pk
재고문의재고: -
328,500
(VAT포함)361,350
소모품
500-P24BT-50UG
재고문의재고: -
Thermo Fisher Scientific 500-P24BT-50UG IL-4 Polyclonal Antibody, Biotin, PeproTech 50 ug pk
CAS: -단위: pk
411,600
(VAT포함)452,760
500-P24BT-25UG
재고문의재고: -
Thermo Fisher Scientific 500-P24BT-25UG IL-4 Polyclonal Antibody, Biotin, PeproTech 25 ug pk
CAS: -단위: pk
328,500
(VAT포함)361,350

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Thermo Fisher Scientific IL-4 Polyclonal Antibody, Biotin, PeproTech

Applications and Tested Dilution

Application Tested Dilution Notes
Western Blot (WB) 0.1–0.2 µg/mL Detection limit: 1.5–3.0 ng/lane (reducing/non-reducing conditions)
ELISA 0.25–1.0 µg/mL Detection limit: 0.2–0.4 ng/well (sandwich ELISA with PeproTech 500-P24)

Product Specifications

Property Description
Species Reactivity Human
Published Species Human
Host/Isotype Rabbit
Class Polyclonal
Type Antibody
Immunogen E. coli-derived Recombinant Human IL-4
Conjugate Biotin
Form Lyophilized
Concentration 0.1–1.0 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS
Contains No preservative
Storage Conditions -20°C
Shipping Conditions Ambient
RRID AB_2930057

Product Specific Information

AA Sequence of recombinant protein:
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human IL-4. Anti-Human IL-4-specific antibody was purified by affinity chromatography and then biotinylated.

Sandwich ELISA:
To detect hIL-4 by sandwich ELISA (using 100 µL/well antibody solution), a concentration of 0.25–1.0 µg/mL of this antibody is required. This biotinylated polyclonal antibody, in conjunction with PeproTech Polyclonal Anti-Human IL-4 (500-P24) as a capture antibody, allows the detection of at least 0.2–0.4 ng/well of Recombinant hIL-4.

Western Blot:
To detect hIL-4 by Western Blot analysis, this antibody can be used at a concentration of 0.1–0.2 µg/mL. Used in conjunction with compatible secondary reagents, the detection limit for Recombinant hIL-4 is 1.5–3.0 ng/lane, under either reducing or non-reducing conditions.

Packaging:
500-P24BT-1MG is provided as 2 × 500 µg.

Target Information

Interleukin-4 (IL-4) is a pleiotropic, immune-modulatory cytokine produced by activated T cells and serves as a ligand for the interleukin-4 receptor. IL-4 exhibits broad biological activity and shares overlapping functions with IL-13 through receptor cross-binding. STAT6 mediates IL-4’s immune regulatory signaling. The IL-4 gene resides within a cytokine cluster on chromosome 5q alongside IL-3, IL-5, IL-13, and CSF2. IL-4, IL-13, and IL-5 are coordinated by long-range regulatory elements spanning approximately 120 kb. IL-4 delta 2 is a known splice variant.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0