
Atlas Antibodies Anti-C14orf159 Antibody
상품 한눈에 보기
Human C14orf159 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC, WB, ICC에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C14orf159 Antibody
Target: chromosome 14 open reading frame 159 (C14orf159)
Type: Polyclonal Antibody against Human C14orf159
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Rabbit polyclonal antibody raised against Human C14orf159 (chromosome 14 open reading frame 159).
Alternative Gene Names
- FLJ39975
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 14 open reading frame 159 |
| Target Gene | C14orf159 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLA |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004442 (74%), Mouse ENSMUSG00000021185 (72%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C14orf178 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf159 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf177 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf119 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.