
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C14orf159 Antibody
상품 한눈에 보기
Human C14orf159 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC, WB, ICC에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 검증됨.
- 카탈로그번호
- HPA052932-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052932-100 Anti-C14orf159 Antibody, chromosome 14 open reading frame 159 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052932-25 Anti-C14orf159 Antibody, chromosome 14 open reading frame 159 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C14orf159 Antibody
Anti-C14orf159 Antibody
Target: chromosome 14 open reading frame 159 (C14orf159)
Type: Polyclonal Antibody against Human C14orf159
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Rabbit polyclonal antibody raised against Human C14orf159 (chromosome 14 open reading frame 159).
Alternative Gene Names
- FLJ39975
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 14 open reading frame 159 |
| Target Gene | C14orf159 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLA |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004442 (74%), Mouse ENSMUSG00000021185 (72%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



