CacheBy
Atlas Antibodies Anti-C14orf159 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf159 Antibody

상품 한눈에 보기

Human C14orf159 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC, WB, ICC에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA052932-100 Anti-C14orf159 Antibody, chromosome 14 open reading frame 159 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052932-25 Anti-C14orf159 Antibody, chromosome 14 open reading frame 159 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf159 Antibody

Anti-C14orf159 Antibody

Target: chromosome 14 open reading frame 159 (C14orf159)
Type: Polyclonal Antibody against Human C14orf159


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Rabbit polyclonal antibody raised against Human C14orf159 (chromosome 14 open reading frame 159).


Alternative Gene Names

  • FLJ39975

Target Information

항목 내용
Target Protein chromosome 14 open reading frame 159
Target Gene C14orf159
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AGAYKTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLA
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000004442 (74%), Mouse ENSMUSG00000021185 (72%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.