Atlas Antibodies Anti-C14orf2 Antibody

상품 한눈에 보기

Human C14orf2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교로 검증되었습니다. 고순도의 Affinity purified 항체로 신뢰성 높은 결과를 제공합니다.

카탈로그번호: HPA060520-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA060520-100 Anti-C14orf2 Antibody, chromosome 14 open reading frame 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA060520-25 Anti-C14orf2 Antibody, chromosome 14 open reading frame 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C14orf2 Antibody

Anti-C14orf2 Antibody

Target: chromosome 14 open reading frame 2 (C14orf2)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human C14orf2

Alternative Gene Names

MP68

Target Information

항목	내용
Target Protein	chromosome 14 open reading frame 2
Target Gene	C14orf2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH