CacheBy
Atlas Antibodies Anti-C14orf178 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf178 Antibody

상품 한눈에 보기

인간 C14orf178 단백질을 표적으로 하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 고품질 버퍼와 방부제가 포함되어 안정적인 보관이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA062581-100 Anti-C14orf178 Antibody, chromosome 14 open reading frame 178 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062581-25 Anti-C14orf178 Antibody, chromosome 14 open reading frame 178 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf178 Antibody

Anti-C14orf178 Antibody

Target: Chromosome 14 open reading frame 178 (C14orf178)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C14orf178.


Alternative Gene Names

  • FLJ25976

Open Datasheet


Target Information

항목 내용
Target Protein Chromosome 14 open reading frame 178
Target Gene C14orf178
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016800 (34%), Mouse ENSMUSG00000037013 (34%)

Antigen Sequence:
MGREMKKTGTPRPFRIEDPNQQPTWHDQPEMGSHYFAQ


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Reference Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.