CacheBy
Atlas Antibodies Anti-C14orf177 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf177 Antibody

상품 한눈에 보기

Human C14orf177 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합. 재조합 발현 검증 완료. 고순도의 Affinity 정제 항체로 신뢰성 높은 단백질 발현 분석에 활용 가능.

카탈로그번호
HPA018091-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018091-100 Anti-C14orf177 Antibody, chromosome 14 open reading frame 177 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018091-25 Anti-C14orf177 Antibody, chromosome 14 open reading frame 177 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf177 Antibody

Anti-C14orf177 Antibody

Target: chromosome 14 open reading frame 177 (C14orf177)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against human C14orf177 protein.


Alternative Gene Names

  • FLJ25773

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 14 open reading frame 177
Target Gene C14orf177
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000028631 (24%), Rat ENSRNOG00000060435 (24%)

Antigen Sequence:
HRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQM


Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.