CacheBy
Atlas Antibodies Anti-C14orf119 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf119 Antibody

상품 한눈에 보기

인간 C14orf119 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 발현 검증 완료. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.

카탈로그번호
HPA003638-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003638-100 Anti-C14orf119 Antibody, chromosome 14 open reading frame 119 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003638-25 Anti-C14orf119 Antibody, chromosome 14 open reading frame 119 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf119 Antibody

Anti-C14orf119 Antibody

Target: chromosome 14 open reading frame 119
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human C14orf119.


Alternative Gene Names

  • FLJ20671

Target Information

항목 내용
Target Protein chromosome 14 open reading frame 119
Target Gene C14orf119
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (84%), Rat (83%)

Antigen Sequence

SLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQ

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet

Open Datasheet


제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.