
Atlas Antibodies Anti-C11orf54 Antibody
Human C11orf54 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat에서 반응성이 검증되었습니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C11orf54 Antibody
Target: chromosome 11 open reading frame 54 (C11orf54)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human C11orf54.
Alternative Gene Names
- PTD012
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 11 open reading frame 54 |
| Target Gene | C11orf54 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAG |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000010887 (93%), Mouse ENSMUSG00000031938 (90%) |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C11orf54 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf53 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf54 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf49 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|