CacheBy
Atlas Antibodies Anti-C11orf54 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf54 Antibody

상품 한눈에 보기

Human C11orf54 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat에서 반응성이 검증되었습니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040511-100 Anti-C11orf54 Antibody, chromosome 11 open reading frame 54 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040511-25 Anti-C11orf54 Antibody, chromosome 11 open reading frame 54 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf54 Antibody

Anti-C11orf54 Antibody

Target: chromosome 11 open reading frame 54 (C11orf54)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human C11orf54.


Alternative Gene Names

  • PTD012

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 54
Target Gene C11orf54
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAG
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000010887 (93%), Mouse ENSMUSG00000031938 (90%)

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.