CacheBy
Atlas Antibodies Anti-C11orf53 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf53 Antibody

상품 한눈에 보기

Human C11orf53 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA073101-100 Anti-C11orf53 Antibody, chromosome 11 open reading frame 53 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073101-25 Anti-C11orf53 Antibody, chromosome 11 open reading frame 53 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf53 Antibody

Anti-C11orf53 Antibody

Target: chromosome 11 open reading frame 53 (C11orf53)
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human C11orf53.

Alternative Gene Names

  • MGC50104

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein chromosome 11 open reading frame 53
Target Gene C11orf53
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012022 (88%), Mouse ENSMUSG00000036027 (88%)

Antigen Sequence:
STSCLSQLESGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSNDLPPKV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.