CacheBy
Atlas Antibodies Anti-C11orf52 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf52 Antibody

상품 한눈에 보기

인간 C11orf52 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 제품으로 높은 특이성과 재현성 제공. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA038388-100 Anti-C11orf52 Antibody, chromosome 11 open reading frame 52 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038388-25 Anti-C11orf52 Antibody, chromosome 11 open reading frame 52 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf52 Antibody

Anti-C11orf52 Antibody

Target: chromosome 11 open reading frame 52 (C11orf52)
Type: Polyclonal Antibody against Human C11orf52


  • IHC (Immunohistochemistry)
  • WB (Western Blot, recombinant expression validation)
    • Recombinant expression validation in WB using target protein overexpression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting Human C11orf52.
Validated for multiple applications with recombinant expression verification.


Alternative Gene Names

  • FLJ25219
  • MGC14839

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 52
Target Gene C11orf52
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MGNRVCCGGSWSCPSTFQKKKKTGSQTRRTLKPQPQQLQQNLPKGHETTGHTYERVLQQQGS
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000051792 (65%), Mouse ENSMUSG00000032062 (63%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.