Atlas Antibodies Anti-C11orf54 Antibody

상품 한눈에 보기

Human C11orf54 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 Western Blot에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Mouse, Rat 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040088-100 Anti-C11orf54 Antibody, chromosome 11 open reading frame 54 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040088-25 Anti-C11orf54 Antibody, chromosome 11 open reading frame 54 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 11 open reading frame 54 (C11orf54)
Supplier: Atlas Antibodies

Polyclonal antibody against human C11orf54, produced in rabbit and affinity purified using PrEST antigen.

항목	내용
Target Protein	chromosome 11 open reading frame 54
Target Gene	C11orf54
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000010887 (93%), Mouse ENSMUSG00000031938 (90%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.

MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAG

IHC Application
WB Application

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.