CacheBy
Atlas Antibodies Anti-C11orf49 Antibody
원본

Atlas Antibodies Anti-C11orf49 Antibody

상품 한눈에 보기

Human C11orf49 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 사용 가능. 재조합 발현 검증 완료. 고순도의 Affinity 정제 항체로 인체 시료 분석에 적합. 40% 글리세롤 기반 안정적 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040280-100 Anti-C11orf49 Antibody, chromosome 11 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040280-25 Anti-C11orf49 Antibody, chromosome 11 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf49 Antibody

Anti-C11orf49 Antibody

Target: chromosome 11 open reading frame 49 (C11orf49)


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human C11orf49.


Alternative Gene Names

FLJ22210, MGC4707

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 49
Target Gene C11orf49
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000014798 (90%), Mouse ENSMUSG00000040591 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Application IHC
Application WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.