
Atlas Antibodies Anti-C10orf88 Antibody
상품 한눈에 보기
Human C10orf88 단백질에 특이적인 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 단백질 발현이 확인됨. PrEST 항원으로 친화정제되었으며, Human에 반응. 연구용으로 RNA-seq 데이터와 비교 검증 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C10orf88 Antibody
Target: chromosome 10 open reading frame 88 (C10orf88)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human C10orf88.
Alternative Gene Names
Em:AC073585.5, FLJ13490
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 10 open reading frame 88 |
| Target Gene | C10orf88 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CSQVNHLHVGNKTECQENITKHGERILGVGMEEQSICSYLEKILSKNMELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQNPNSP |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000040177 | 72% |
| Rat | ENSRNOG00000020597 | 68% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C10orf90 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf90 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf88 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf76 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf76 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.