CacheBy
Atlas Antibodies Anti-C10orf88 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C10orf88 Antibody

상품 한눈에 보기

Human C10orf88 단백질에 특이적인 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 단백질 발현이 확인됨. PrEST 항원으로 친화정제되었으며, Human에 반응. 연구용으로 RNA-seq 데이터와 비교 검증 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040991-100 Anti-C10orf88 Antibody, chromosome 10 open reading frame 88 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040991-25 Anti-C10orf88 Antibody, chromosome 10 open reading frame 88 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C10orf88 Antibody

Anti-C10orf88 Antibody

Target: chromosome 10 open reading frame 88 (C10orf88)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human C10orf88.

Alternative Gene Names

Em:AC073585.5, FLJ13490

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein chromosome 10 open reading frame 88
Target Gene C10orf88
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence CSQVNHLHVGNKTECQENITKHGERILGVGMEEQSICSYLEKILSKNMELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQNPNSP

Verified Species Reactivity

Human

Interspecies Information

종 Ortholog ID 항원 서열 유사도
Mouse ENSMUSG00000040177 72%
Rat ENSRNOG00000020597 68%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.