CacheBy
Atlas Antibodies Anti-C10orf90 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C10orf90 Antibody

상품 한눈에 보기

Human C10orf90 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 글리세롤/PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA038648-100 Anti-C10orf90 Antibody, chromosome 10 open reading frame 90 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038648-25 Anti-C10orf90 Antibody, chromosome 10 open reading frame 90 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C10orf90 Antibody

Anti-C10orf90 Antibody

Target: chromosome 10 open reading frame 90 (C10orf90)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human C10orf90, also known as bA422P15.2, FATS, FLJ32938.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.


  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein chromosome 10 open reading frame 90
Target Gene C10orf90
Alternative Gene Names bA422P15.2, FATS, FLJ32938

Antigen Sequence

AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD

Verified Species Reactivity

  • Human

Interspecies Identity
| 종 | Ortholog ID | 항원 서열 유사도 |
|----|--------------|----------------|
| Rat | ENSRNOG00000027542 | 62% |
| Mouse | ENSMUSG00000030994 | 59% |


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Base Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.