
Atlas Antibodies Anti-C10orf76 Antibody
상품 한눈에 보기
Human C10orf76 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 정제되었으며, 높은 종간 보존성(마우스 및 랫트 100%)을 보입니다. PBS/glycerol buffer에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C10orf76 Antibody
Target: chromosome 10 open reading frame 76 (C10orf76)
Type: Polyclonal Antibody against Human C10orf76
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human C10orf76.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- FLJ13114
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 10 open reading frame 76 |
| Target Gene | C10orf76 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | LEGKLESLDGEELMKIKDNINCLFQHCIQALGEEHPIRVVNALQTLCALIRGVHQKNKSTSGFDIINMLMGFDKAELCMKNLM |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000039901 | 100% |
| Rat | ENSRNOG00000025523 | 100% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C10orf90 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf88 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf76 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf76 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C10orf67 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.