CacheBy
Atlas Antibodies Anti-C10orf76 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C10orf76 Antibody

상품 한눈에 보기

Human C10orf76 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 형태로 제공됩니다. 인간에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050913-100 Anti-C10orf76 Antibody, chromosome 10 open reading frame 76 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050913-25 Anti-C10orf76 Antibody, chromosome 10 open reading frame 76 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C10orf76 Antibody

Anti-C10orf76 Antibody

Target: chromosome 10 open reading frame 76 (C10orf76)
Type: Polyclonal Antibody against Human C10orf76


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against the human C10orf76 protein (chromosome 10 open reading frame 76).


Alternative Gene Names

  • FLJ13114

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 10 open reading frame 76
Target Gene C10orf76
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LEGKLESLDGEELMKIKDNINCLFQHCIQALGEEHPIRVVNALQTLCALIRGVHQKNKSTSGFDIINMLMGFDKAELCMKNLM
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000025523 (100%), Mouse ENSMUSG00000039901 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.