CacheBy
Atlas Antibodies Anti-C10orf90 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C10orf90 Antibody

상품 한눈에 보기

Human C10orf90 단백질을 인식하는 Rabbit Polyclonal IgG 항체로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존 처리되어 있습니다.

카탈로그번호
HPA057599-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057599-100 Anti-C10orf90 Antibody, chromosome 10 open reading frame 90 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057599-25 Anti-C10orf90 Antibody, chromosome 10 open reading frame 90 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C10orf90 Antibody

Anti-C10orf90 Antibody

Target: chromosome 10 open reading frame 90 (C10orf90)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human C10orf90


Alternative Gene Names

  • bA422P15.2
  • FATS
  • FLJ32938

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 10 open reading frame 90
Target Gene C10orf90
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000027542 (62%), Mouse ENSMUSG00000030994 (59%)

Antigen Sequence:
AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.