
Atlas Antibodies Anti-ATP5A1 Antibody
상품 한눈에 보기
인간 ATP5A1 단백질을 표적하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립적 항체 검증을 통해 단백질 발현 확인에 적합합니다. PrEST 항원으로 정제되었으며, 높은 종간 서열 일치도를 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATP5A1 Antibody
ATP synthase, H⁺ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human ATP5A1
Alternative Gene Names
ATP5A, ATP5AL2, ATPM, hATP1, OMR, ORM
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATP synthase, H⁺ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle |
| Target Gene | ATP5A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 서열 일치도 |
|---|---|---|
| Rat | ENSRNOG00000017032 | 99% |
| Mouse | ENSMUSG00000025428 | 99% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATP5A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP5B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP5A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP4B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.