AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ATP5A1 Antibody
상품 한눈에 보기
인간 ATP5A1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. 토끼 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. 인간, 생쥐, 랫트에 높은 반응성. 글리세롤/PBS 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040622-100 Anti-ATP5A1 Antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040622-25 Anti-ATP5A1 Antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ATP5A1 Antibody
Anti-ATP5A1 Antibody
ATP synthase, H⁺ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle
Recommended Applications
- IHC Independent Validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human ATP5A1
Alternative Gene Names
ATP5A, ATP5AL2, ATPM, hATP1, OMR, ORM
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATP synthase, H⁺ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle |
| Target Gene | ATP5A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000017032 (99%), Mouse ENSMUSG00000025428 (99%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.