CacheBy
Atlas Antibodies Anti-ATP5A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP5A1 Antibody

상품 한눈에 보기

인간 ATP5A1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. 토끼 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. 인간, 생쥐, 랫트에 높은 반응성. 글리세롤/PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040622-100 Anti-ATP5A1 Antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040622-25 Anti-ATP5A1 Antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP5A1 Antibody

Anti-ATP5A1 Antibody

ATP synthase, H⁺ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle

  • IHC Independent Validation
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB Independent Validation
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human ATP5A1

Alternative Gene Names

ATP5A, ATP5AL2, ATPM, hATP1, OMR, ORM

Open Datasheet

Target Information

항목 내용
Target Protein ATP synthase, H⁺ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle
Target Gene ATP5A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000017032 (99%), Mouse ENSMUSG00000025428 (99%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.