
Atlas Antibodies Anti-ATP4B Antibody
상품 한눈에 보기
인간 ATP4B 단백질을 표적으로 하는 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간 반응성이 검증되었고, 높은 종간 서열 유사성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATP4B Antibody
ATPase, H+/K+ exchanging, beta polypeptide
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human ATP4B.
Alternative Gene Names
ATP6B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATPase, H+/K+ exchanging, beta polypeptide |
| Target Gene | ATP4B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (83%), Rat (80%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATP5B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP5A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP4A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.