CacheBy
Atlas Antibodies Anti-ATP4B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP4B Antibody

상품 한눈에 보기

Human ATP4B 단백질을 인식하는 토끼 다클론 항체로, IHC 정량 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교하여 Orthogonal validation 완료. PrEST 항원을 이용해 친화 정제되었으며, 고품질의 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045400-100 Anti-ATP4B Antibody, ATPase, H+/K+ exchanging, beta polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045400-25 Anti-ATP4B Antibody, ATPase, H+/K+ exchanging, beta polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP4B Antibody

Anti-ATP4B Antibody

ATPase, H+/K+ exchanging, beta polypeptide


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human ATP4B.


Alternative Gene Names

  • ATP6B

Open Datasheet


Target Information

항목 내용
Target Protein ATPase, H+/K+ exchanging, beta polypeptide
Target Gene ATP4B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000031449 (83%), Rat ENSRNOG00000018543 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.