CacheBy
Atlas Antibodies Anti-ATP5B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP5B Antibody

상품 한눈에 보기

인간 ATP5B 단백질을 인식하는 토끼 폴리클로날 항체로 IHC, WB, ICC에 적합합니다. 독립 항체 비교 및 siRNA 노크다운을 통한 검증 완료. 고순도 친화 정제 제품으로 사람, 생쥐, 랫트에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001520-100 Anti-ATP5B Antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001520-25 Anti-ATP5B Antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP5B Antibody

Anti-ATP5B Antibody

ATP synthase, H⁺ transporting, mitochondrial F1 complex, beta polypeptide


  • IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Validated for immunocytochemistry.

Product Description

Polyclonal antibody against human ATP5B.


Alternative Gene Names

  • ATPSB

Target Information

항목 내용
Target Protein ATP synthase, H⁺ transporting, mitochondrial F1 complex, beta polypeptide
Target Gene ATP5B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000025393 (95%), Rat ENSRNOG00000002840 (95%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.