
Atlas Antibodies Anti-ATP4A Antibody
Human ATP4A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터를 통한 Orthogonal Validation 완료. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 기반 완충액에 보존제 포함. 인간 ATP4A 단백질 분석에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATP4A Antibody
ATPase, H+/K+ exchanging, alpha polypeptide
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ATP4A
Alternative Gene Names
ATP6A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATPase, H+/K+ exchanging, alpha polypeptide |
| Target Gene | ATP4A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000020985 | 95% |
| Mouse | ENSMUSG00000005553 | 95% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATP4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP4A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP4A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP2C2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|