CacheBy
Atlas Antibodies Anti-ATP4A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP4A Antibody

상품 한눈에 보기

Human ATP4A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터를 통한 Orthogonal Validation 완료. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 기반 완충액에 보존제 포함. 인간 ATP4A 단백질 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039154-100 Anti-ATP4A Antibody, ATPase, H+/K+ exchanging, alpha polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039154-25 Anti-ATP4A Antibody, ATPase, H+/K+ exchanging, alpha polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP4A Antibody

Anti-ATP4A Antibody

ATPase, H+/K+ exchanging, alpha polypeptide


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human ATP4A


Alternative Gene Names

ATP6A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ATPase, H+/K+ exchanging, alpha polypeptide
Target Gene ATP4A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ

Verified Species Reactivity

Human


Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000020985 95%
Mouse ENSMUSG00000005553 95%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.