Thermo Fisher Scientific CD298 Recombinant Rabbit Monoclonal Antibody (ARC2205)
CD298 단백질을 인식하는 재조합 토끼 단클론 항체로, Western blot, IHC, ELISA에 사용 가능. 인간, 생쥐, 랫트 반응성. 고순도 친화 크로마토그래피 정제 제품으로 안정적인 PBS/glycerol buffer에 보관. 연구용 전용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Expression System | HEK293 cells |
| Class | Recombinant Monoclonal |
| Type | Antibody |
| Clone | ARC2205 |
| Immunogen | Synthetic peptide corresponding to amino acids 180–279 of human ATP1B3 (P54709) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.45 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol, 0.05% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2897854 |
Product Specific Information
Positive Samples:
293T, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat lung, Rat testis, Rat spleen
Immunogen Sequence:
GLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Target Information
The protein encoded by this gene belongs to the family of Na⁺/K⁺ and H⁺/K⁺ ATPase beta chain proteins, specifically the Na⁺/K⁺-ATPase subfamily.
Na⁺/K⁺-ATPase is an integral membrane protein responsible for maintaining electrochemical gradients of sodium and potassium ions across the plasma membrane.
These gradients are essential for osmoregulation, sodium-coupled transport of organic and inorganic molecules, and electrical excitability of nerve and muscle cells.
The enzyme consists of two subunits: a large catalytic alpha subunit and a smaller glycoprotein beta subunit. The beta subunit regulates the number of sodium pumps transported to the plasma membrane through alpha/beta heterodimer assembly.
This gene encodes the beta 3 subunit of Na⁺/K⁺-ATPase, with a pseudogene located on chromosome 2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA1 ATPase Recombinant Rabbit Monoclonal Antibody (ARC2207)
699,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Calsequestrin Recombinant Rabbit Monoclonal Antibody (ARC2209)
699,900원
Thermo Fisher Scientific
Thermo Fisher Scientific CD298 Recombinant Rabbit Monoclonal Antibody (ARC2205)
699,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Abl2 Recombinant Rabbit Monoclonal Antibody (ARC2200)
699,900원
Thermo Fisher Scientific
Thermo Fisher Scientific FLAP Recombinant Rabbit Monoclonal Antibody (ARC2204)
699,900원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|