Thermo Fisher Scientific CD298 Recombinant Rabbit Monoclonal Antibody (ARC2205)
CD298 단백질을 인식하는 재조합 토끼 단클론 항체로, Western blot, IHC, ELISA에 사용 가능. 인간, 생쥐, 랫트 반응성. 고순도 친화 크로마토그래피 정제 제품으로 안정적인 PBS/glycerol buffer에 보관. 연구용 전용.
- 카탈로그번호
- MA537934
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CD298 Recombinant Rabbit Monoclonal Antibody (ARC2205)
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Expression System | HEK293 cells |
| Class | Recombinant Monoclonal |
| Type | Antibody |
| Clone | ARC2205 |
| Immunogen | Synthetic peptide corresponding to amino acids 180–279 of human ATP1B3 (P54709) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.45 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol, 0.05% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2897854 |
Product Specific Information
Positive Samples:
293T, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat lung, Rat testis, Rat spleen
Immunogen Sequence:
GLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Target Information
The protein encoded by this gene belongs to the family of Na⁺/K⁺ and H⁺/K⁺ ATPase beta chain proteins, specifically the Na⁺/K⁺-ATPase subfamily.
Na⁺/K⁺-ATPase is an integral membrane protein responsible for maintaining electrochemical gradients of sodium and potassium ions across the plasma membrane.
These gradients are essential for osmoregulation, sodium-coupled transport of organic and inorganic molecules, and electrical excitability of nerve and muscle cells.
The enzyme consists of two subunits: a large catalytic alpha subunit and a smaller glycoprotein beta subunit. The beta subunit regulates the number of sodium pumps transported to the plasma membrane through alpha/beta heterodimer assembly.
This gene encodes the beta 3 subunit of Na⁺/K⁺-ATPase, with a pseudogene located on chromosome 2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.