CacheBy
Atlas Antibodies Anti-NBR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NBR1 Antibody

상품 한눈에 보기

인간 NBR1 단백질을 인식하는 폴리클로날 항체로, BRCA1 인접 유전자 연구에 적합합니다. 토끼에서 유래한 IgG 항체이며, Affinity purification으로 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 다양한 응용 실험에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023999-100 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023999-25 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NBR1 Antibody

Anti-NBR1 Antibody

Target: neighbor of BRCA1 gene 1 (NBR1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human NBR1.

  • ICC (Immunocytochemistry)
    (이미지 내 텍스트: ICC)

Alternative Gene Names

1A1-3B, CA125, KIAA0049, M17S2

Open Datasheet


Target Information

항목 내용
Target Protein neighbor of BRCA1 gene 1
Target Gene NBR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000017119 75%
Rat ENSRNOG00000020730 73%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.