Atlas Antibodies Anti-NBR1 Antibody
상품 한눈에 보기
인간 NBR1 단백질을 인식하는 폴리클로날 항체로, BRCA1 인접 유전자 연구에 적합합니다. 토끼에서 유래한 IgG 항체이며, Affinity purification으로 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 다양한 응용 실험에 사용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NBR1 Antibody
Target: neighbor of BRCA1 gene 1 (NBR1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human NBR1.
Recommended Applications
- ICC (Immunocytochemistry)
(이미지 내 텍스트: ICC)
Alternative Gene Names
1A1-3B, CA125, KIAA0049, M17S2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neighbor of BRCA1 gene 1 |
| Target Gene | NBR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000017119 | 75% |
| Rat | ENSRNOG00000020730 | 73% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.