AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NBR1 Antibody
상품 한눈에 보기
인간 NBR1 단백질을 인식하는 폴리클로날 항체로, BRCA1 인접 유전자 연구에 적합합니다. 토끼에서 유래한 IgG 항체이며, Affinity purification으로 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 다양한 응용 실험에 사용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023999-100 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023999-25 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NBR1 Antibody
Anti-NBR1 Antibody
Target: neighbor of BRCA1 gene 1 (NBR1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human NBR1.
Recommended Applications
- ICC (Immunocytochemistry)
(이미지 내 텍스트: ICC)
Alternative Gene Names
1A1-3B, CA125, KIAA0049, M17S2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neighbor of BRCA1 gene 1 |
| Target Gene | NBR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000017119 | 75% |
| Rat | ENSRNOG00000020730 | 73% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.