CacheBy
Atlas Antibodies Anti-NCAM2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCAM2 Antibody

상품 한눈에 보기

인간 NCAM2 단백질을 인식하는 폴리클로날 항체로 신경세포 접착 분자 연구에 적합합니다. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 반응하며 Rat, Mouse와 높은 서열 유사성을 가집니다. IHC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030900-100 Anti-NCAM2 Antibody, neural cell adhesion molecule 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030900-25 Anti-NCAM2 Antibody, neural cell adhesion molecule 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCAM2 Antibody

Anti-NCAM2 Antibody

Target Information

  • Target Protein: Neural cell adhesion molecule 2
  • Target Gene: NCAM2
  • Alternative Gene Names: MGC51008, NCAM21

Product Description

Polyclonal antibody against human NCAM2.
Recommended for applications such as immunohistochemistry (IHC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPY

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000002126 (91%)
  • Mouse ENSMUSG00000022762 (89%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.