CacheBy
Atlas Antibodies Anti-NCAM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCAM1 Antibody

상품 한눈에 보기

인간 NCAM1(neural cell adhesion molecule 1)을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터와 비교한 정교한 Orthogonal 검증 완료. 고순도의 Affinity 정제 항체로 안정적인 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039835-100 Anti-NCAM1 Antibody, neural cell adhesion molecule 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039835-25 Anti-NCAM1 Antibody, neural cell adhesion molecule 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCAM1 Antibody

Anti-NCAM1 Antibody

Target: Neural cell adhesion molecule 1 (NCAM1)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human NCAM1.


Alternative Gene Names

CD56, NCAM

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Neural cell adhesion molecule 1
Target Gene NCAM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000031890 (94%), Mouse ENSMUSG00000039542 (93%)

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative.
Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.