CacheBy
Atlas Antibodies Anti-NBR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NBR1 Antibody

상품 한눈에 보기

Human NBR1 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증되었으며, Mouse 및 Rat과도 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022999-100 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022999-25 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NBR1 Antibody

Anti-NBR1 Antibody

Target: neighbor of BRCA1 gene 1 (NBR1)
Type: Polyclonal Antibody against Human NBR1


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human NBR1 (neighbor of BRCA1 gene 1).
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • 1A1-3B
  • CA125
  • KIAA0049
  • M17S2

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (PrEST antigen):
HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR


Species Reactivity

  • Verified: Human
  • Interspecies Identity:
    • Mouse (ENSMUSG00000017119) – 75%
    • Rat (ENSRNOG00000020730) – 73%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal concentrations and conditions experimentally.

Material Safety Data Sheet (MSDS)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.