Atlas Antibodies Anti-NBR1 Antibody

상품 한눈에 보기

Human NBR1 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증되었으며, Mouse 및 Rat과도 높은 서열 유사성을 가집니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA022999-100 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA022999-25 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NBR1 Antibody

Anti-NBR1 Antibody

Target: neighbor of BRCA1 gene 1 (NBR1)
Type: Polyclonal Antibody against Human NBR1

Recommended Applications

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human NBR1 (neighbor of BRCA1 gene 1).
Affinity purified using the PrEST antigen as affinity ligand.

Alternative Gene Names

1A1-3B
CA125
KIAA0049
M17S2

Open Datasheet (PDF)

Antigen Information

Antigen Sequence (PrEST antigen):
HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR

Species Reactivity

Verified: Human
Interspecies Identity:
- Mouse (ENSMUSG00000017119) – 75%
- Rat (ENSRNOG00000020730) – 73%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Determine optimal concentrations and conditions experimentally.