CacheBy
Atlas Antibodies Anti-NBR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NBR1 Antibody

상품 한눈에 보기

인간 NBR1 단백질을 표적으로 하는 폴리클로날 항체입니다. 토끼에서 생산되었으며 IgG 아이소타입입니다. 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며 휴먼에 검증된 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022944-100 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022944-25 Anti-NBR1 Antibody, neighbor of BRCA1 gene 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NBR1 Antibody

Anti-NBR1 Antibody

Target: neighbor of BRCA1 gene 1
Supplier: Atlas Antibodies


면역세포화학 (ICC)


Product Description

Polyclonal antibody against human NBR1.


Alternative Gene Names

  • 1A1-3B
  • CA125
  • KIAA0049
  • M17S2

Open Datasheet


Target Information

항목 내용
Target Protein neighbor of BRCA1 gene 1
Target Gene NBR1
Verified Species Reactivity Human
Interspecies Identity Mouse (75%), Rat (73%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.