Thermo Fisher Scientific SERCA1 ATPase Polyclonal Antibody
Rabbit polyclonal antibody against SERCA1 ATPase for WB, IHC, ICC/IF. Human, mouse, rat 반응성. 항원 친화 크로마토그래피 정제, 동결건조 형태. 연구용으로 세포 내 칼슘 펌프 관련 단백질 분석에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 1:250 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1–32aa: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745951 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ATP-dependent calcium pumps are responsible, in part, for maintaining low cytoplasmic free calcium concentrations. These pumps, located in intracellular organelles, are encoded by a family of structurally related enzymes known as sarcoplasmic or endoplasmic reticulum calcium (SERCA) ATPases.
- SERCA1 gene: Expressed exclusively in type II (fast) skeletal muscle.
- SERCA2 gene: Tissue-dependent processing generates SERCA2a (muscle-specific form in type I skeletal, cardiac, and smooth muscle) and SERCA2b (expressed in all cell types).
- SERCA3 gene: Less characterized, found in non-muscle cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA1 ATPase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ATF2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA1 ATPase Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|