원본
Thermo Fisher Scientific SERCA1 ATPase Polyclonal Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against SERCA1 ATPase for WB, IHC, ICC/IF. Human, mouse, rat 반응성. 항원 친화 크로마토그래피 정제, 동결건조 형태. 연구용으로 세포 내 칼슘 펌프 관련 단백질 분석에 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 04:17
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578835 SERCA1 ATPase Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific SERCA1 ATPase Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 1:250 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1–32aa: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745951 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ATP-dependent calcium pumps are responsible, in part, for maintaining low cytoplasmic free calcium concentrations. These pumps, located in intracellular organelles, are encoded by a family of structurally related enzymes known as sarcoplasmic or endoplasmic reticulum calcium (SERCA) ATPases.
- SERCA1 gene: Expressed exclusively in type II (fast) skeletal muscle.
- SERCA2 gene: Tissue-dependent processing generates SERCA2a (muscle-specific form in type I skeletal, cardiac, and smooth muscle) and SERCA2b (expressed in all cell types).
- SERCA3 gene: Less characterized, found in non-muscle cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ATF2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SERCA1 ATPase Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.