Thermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody
SERCA2 ATPase 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC/IF에 사용 가능. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | — |
| Immunocytochemistry (ICC/IF) | 1:100 | — |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the N-terminus of human SERCA2 ATPase (1–32aa: MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745953 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes one of the SERCA Ca(2+)-ATPases, intracellular pumps located in the sarcoplasmic or endoplasmic reticulum of muscle cells. The enzyme catalyzes ATP hydrolysis coupled with calcium translocation from the cytosol into the sarcoplasmic reticulum lumen, regulating the contraction/relaxation cycle.
Mutations in this gene cause Darier-White disease (keratosis follicularis), an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization.
Alternative splicing results in multiple transcript variants encoding different isoforms.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA3 ATPase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ATP4B Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SERCA1 ATPase Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|