Thermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody
SERCA2 ATPase 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC/IF에 사용 가능. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SERCA2 ATPase Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | — |
| Immunocytochemistry (ICC/IF) | 1:100 | — |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the N-terminus of human SERCA2 ATPase (1–32aa: MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745953 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes one of the SERCA Ca(2+)-ATPases, intracellular pumps located in the sarcoplasmic or endoplasmic reticulum of muscle cells. The enzyme catalyzes ATP hydrolysis coupled with calcium translocation from the cytosol into the sarcoplasmic reticulum lumen, regulating the contraction/relaxation cycle.
Mutations in this gene cause Darier-White disease (keratosis follicularis), an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization.
Alternative splicing results in multiple transcript variants encoding different isoforms.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.