
Atlas Antibodies Anti-MRPS28 Antibody
상품 한눈에 보기
Human MRPS28 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 다양한 종간 반응성 정보 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPS28 Antibody
Target: mitochondrial ribosomal protein S28
Clonality: Polyclonal
Host: Rabbit
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MRPS28 (mitochondrial ribosomal protein S28).
Alternative Gene Names
HSPC007, MRP-S28, MRPS35
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S28 |
| Target Gene | MRPS28 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQM |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000040269 (62%), Rat ENSRNOG00000032630 (60%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPS30 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS31 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS28 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS25 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS31 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.