CacheBy
Atlas Antibodies Anti-MRPS31 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS31 Antibody

상품 한눈에 보기

인간 MRPS31 단백질을 인식하는 토끼 폴리클로날 항체입니다. 미토콘드리아 리보솜 단백질 S31 연구에 적합하며, IHC 및 WB 응용에 권장됩니다. Affinity purification 방식으로 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다.

카탈로그번호
HPA046344-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046344-100 Anti-MRPS31 Antibody, mitochondrial ribosomal protein S31 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046344-25 Anti-MRPS31 Antibody, mitochondrial ribosomal protein S31 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS31 Antibody

Anti-MRPS31 Antibody

Target: mitochondrial ribosomal protein S31 (MRPS31)
Type: Polyclonal Antibody against Human MRPS31

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human MRPS31 (mitochondrial ribosomal protein S31).

Alternative Gene Names

  • IMOGN38

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mitochondrial ribosomal protein S31
Target Gene MRPS31
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QLATVNEQPLQNGFEELIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEH
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011839 (90%), Mouse ENSMUSG00000031533 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.