
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPS31 Antibody
상품 한눈에 보기
Human MRPS31 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 유래 IgG로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 휴먼에 대해 검증된 반응성을 보입니다. PBS/glycerol buffer에 보존되어 있습니다.
- 카탈로그번호
- HPA039083-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039083-100 Anti-MRPS31 Antibody, mitochondrial ribosomal protein S31 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039083-25 Anti-MRPS31 Antibody, mitochondrial ribosomal protein S31 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPS31 Antibody
Anti-MRPS31 Antibody
Target: Mitochondrial ribosomal protein S31
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human MRPS31
Alternative Gene Names
- IMOGN38
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mitochondrial ribosomal protein S31 |
| Target Gene | MRPS31 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000011839 (90%) Mouse ENSMUSG00000031533 (86%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QLATVNEQPLQNGFEELIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEH
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



