
Atlas Antibodies Anti-MRPS31 Antibody
상품 한눈에 보기
Human MRPS31 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 유래 IgG로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 휴먼에 대해 검증된 반응성을 보입니다. PBS/glycerol buffer에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPS31 Antibody
Target: Mitochondrial ribosomal protein S31
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human MRPS31
Alternative Gene Names
- IMOGN38
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mitochondrial ribosomal protein S31 |
| Target Gene | MRPS31 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000011839 (90%) Mouse ENSMUSG00000031533 (86%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QLATVNEQPLQNGFEELIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEH
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPS27 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS30 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS31 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS28 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS25 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.