CacheBy
Atlas Antibodies Anti-MRPS31 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS31 Antibody

상품 한눈에 보기

Human MRPS31 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit 유래 IgG로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 휴먼에 대해 검증된 반응성을 보입니다. PBS/glycerol buffer에 보존되어 있습니다.

카탈로그번호
HPA039083-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039083-100 Anti-MRPS31 Antibody, mitochondrial ribosomal protein S31 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039083-25 Anti-MRPS31 Antibody, mitochondrial ribosomal protein S31 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS31 Antibody

Anti-MRPS31 Antibody

Target: Mitochondrial ribosomal protein S31
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human MRPS31


Alternative Gene Names

  • IMOGN38

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Mitochondrial ribosomal protein S31
Target Gene MRPS31
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011839 (90%)
Mouse ENSMUSG00000031533 (86%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QLATVNEQPLQNGFEELIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEH


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.