
Atlas Antibodies Anti-MRPS30 Antibody
상품 한눈에 보기
Human MRPS30 단백질을 인식하는 Rabbit Polyclonal 항체로, 미토콘드리아 리보솜 단백질 S30 연구용에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPS30 Antibody
Target: mitochondrial ribosomal protein S30 (MRPS30)
Type: Polyclonal Antibody against Human MRPS30
Recommended Applications
면역조직화학(IHC) 등 다양한 응용에 사용 가능
Product Description
Rabbit Polyclonal Antibody against Human MRPS30 (mitochondrial ribosomal protein S30)
Alternative Gene Names
PAP, PDCD9
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S30 |
| Target Gene | MRPS30 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGH |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000021731 (54%), Rat ENSRNOG00000012136 (53%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPS6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS27 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS30 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS31 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS28 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.