CacheBy
Atlas Antibodies Anti-MRPS25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS25 Antibody

상품 한눈에 보기

Human MRPS25 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성이 검증되었으며, 40% glycerol 기반의 PBS 버퍼에 보존됩니다.

카탈로그번호
HPA043490-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043490-100 Anti-MRPS25 Antibody, mitochondrial ribosomal protein S25 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043490-25 Anti-MRPS25 Antibody, mitochondrial ribosomal protein S25 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS25 Antibody

Anti-MRPS25 Antibody

Target: mitochondrial ribosomal protein S25
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human MRPS25.


Alternative Gene Names

DKFZp313H0817, FLJ00023, MRP-S25, RPMS25

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein S25
Target Gene MRPS25
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD

Species Reactivity

항목 내용
Verified Species Human
Orthologs (Identity) Rat ENSRNOG00000010912 (80%), Mouse ENSMUSG00000014551 (80%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.