CacheBy
Atlas Antibodies Anti-MCM8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCM8 Antibody

상품 한눈에 보기

Human MCM8 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC 응용에 적합함. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 보임. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.

카탈로그번호
HPA066433-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066433-100 Anti-MCM8 Antibody, minichromosome maintenance 8 homologous recombination repair factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066433-25 Anti-MCM8 Antibody, minichromosome maintenance 8 homologous recombination repair factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCM8 Antibody

Anti-MCM8 Antibody

minichromosome maintenance 8 homologous recombination repair factor

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human MCM8

Alternative Gene Names

C20orf154, dJ967N21.5, MGC119522, MGC119523, MGC12866, MGC4816, REC

Open Datasheet

Target Information

항목 내용
Target Protein minichromosome maintenance 8 homologous recombination repair factor
Target Gene MCM8
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000027353 (88%), Rat ENSRNOG00000021272 (87%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.