
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MCM5 Antibody
상품 한눈에 보기
Human MCM5 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증됨. Recombinant PrEST 항원을 이용해 정제되었으며, Rabbit에서 생산됨. Human, Mouse, Rat에 높은 교차 반응성을 보임. 세포 증식 및 DNA 복제 연구에 적합.
- 카탈로그번호
- HPA052880-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052880-100 Anti-MCM5 Antibody, minichromosome maintenance complex component 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052880-25 Anti-MCM5 Antibody, minichromosome maintenance complex component 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MCM5 Antibody
Anti-MCM5 Antibody
Target: minichromosome maintenance complex component 5 (MCM5)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Recombinant expression): Validation using target protein overexpression.
Product Description
Polyclonal antibody against Human MCM5.
Alternative Gene Names
- CDC46
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | minichromosome maintenance complex component 5 |
| Target Gene | MCM5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000005410 (97%), Rat ENSRNOG00000014336 (96%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
NRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Open Datasheet (PDF)
Material Safety Data Sheet (Sodium Azide)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



