
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MCM6 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-MCM6 Antibody는 인간 MCM6 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal 및 Genetic validation을 거쳐 높은 특이성과 재현성을 보장하며, Rabbit IgG 형으로 정제된 제품입니다.
- 카탈로그번호
- HPA004818-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA004818-100 Anti-MCM6 Antibody, minichromosome maintenance complex component 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004818-25 Anti-MCM6 Antibody, minichromosome maintenance complex component 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MCM6 Antibody
Anti-MCM6 Antibody
Target: minichromosome maintenance complex component 6 (MCM6)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation: Protein expression verified using IHC compared to RNA-seq data of corresponding target in high and low expression tissues.
- Genetic validation: Verified in WB by siRNA knockdown.
- ICC: Suitable for immunocytochemistry.
Product Description
Polyclonal antibody against Human MCM6
Alternative Gene Names
- Mis5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | minichromosome maintenance complex component 6 |
| Target Gene | MCM6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000026355 (97%), Rat ENSRNOG00000003703 (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as ligand |
Antigen Sequence
VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



