CacheBy
Atlas Antibodies Anti-MCM7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCM7 Antibody

상품 한눈에 보기

Human MCM7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증을 거쳤습니다. 고순도 Affinity 정제 방식으로 제조되었습니다.

카탈로그번호
HPA003898-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003898-100 Anti-MCM7 Antibody, minichromosome maintenance complex component 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003898-25 Anti-MCM7 Antibody, minichromosome maintenance complex component 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCM7 Antibody

Anti-MCM7 Antibody

Target: minichromosome maintenance complex component 7 (MCM7)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human MCM7.


Alternative Gene Names

CDC47, MCM2, PPP1R104

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein minichromosome maintenance complex component 7
Target Gene MCM7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGE
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000001349 (91%), Mouse ENSMUSG00000029730 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.