
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAPK8IP1 Antibody
상품 한눈에 보기
Human MAPK8IP1 단백질을 인식하는 rabbit polyclonal antibody로, WB 및 ICC에 적합. PrEST 항원으로 친화 정제된 고품질 항체. 인간에 대한 검증된 반응성과 높은 종간 서열 동일성 보유. 안정적인 PBS/glycerol buffer로 보존.
- 카탈로그번호
- HPA070332-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA070332-100 Anti-MAPK8IP1 Antibody, mitogen-activated protein kinase 8 interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070332-25 Anti-MAPK8IP1 Antibody, mitogen-activated protein kinase 8 interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAPK8IP1 Antibody
Anti-MAPK8IP1 Antibody
Target Information
- Target Protein: Mitogen-activated protein kinase 8 interacting protein 1
- Target Gene: MAPK8IP1
- Alternative Gene Names: IB1, JIP-1, JIP1, PRKM8IP
Product Description
Polyclonal antibody against human MAPK8IP1.
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000058478 | 98% |
| Mouse | ENSMUSG00000027223 | 98% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



