Atlas Antibodies Anti-MAPK8IP1 Antibody
상품 한눈에 보기
Human MAPK8IP1을 인식하는 Rabbit Polyclonal 항체로 WB 및 ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. IB1/JIP1 유전자 타깃 연구에 활용 가능. Human 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAPK8IP1 Antibody
Target: mitogen-activated protein kinase 8 interacting protein 1 (MAPK8IP1)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human MAPK8IP1.
Alternative Gene Names
IB1, JIP-1, JIP1, PRKM8IP
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Sequence:
GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC
Species Reactivity
- Verified: Human
- Interspecies Information:
- Rat (ENSRNOG00000058478) – 98% sequence identity
- Mouse (ENSMUSG00000027223) – 98% sequence identity
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 최적의 농도 및 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-MAPKAP1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAPK8IP3 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAPK8IP1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAPK8IP1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAPK8IP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.