
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAPK8IP1 Antibody
상품 한눈에 보기
Human MAPK8IP1을 인식하는 Rabbit Polyclonal 항체로 WB 및 ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. IB1/JIP1 유전자 타깃 연구에 활용 가능. Human 반응성 검증 완료.
- 카탈로그번호
- HPA079657-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA079657-100 Anti-MAPK8IP1 Antibody, mitogen-activated protein kinase 8 interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA079657-25 Anti-MAPK8IP1 Antibody, mitogen-activated protein kinase 8 interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAPK8IP1 Antibody
Anti-MAPK8IP1 Antibody
Target: mitogen-activated protein kinase 8 interacting protein 1 (MAPK8IP1)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human MAPK8IP1.
Alternative Gene Names
IB1, JIP-1, JIP1, PRKM8IP
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Sequence:
GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC
Species Reactivity
- Verified: Human
- Interspecies Information:
- Rat (ENSRNOG00000058478) – 98% sequence identity
- Mouse (ENSMUSG00000027223) – 98% sequence identity
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 최적의 농도 및 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



