
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAPK8IP1 Antibody
상품 한눈에 보기
인간 MAPK8IP1 단백질을 인식하는 토끼 폴리클로날 항체입니다. WB 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 반응하며, 마우스 및 랫트와 98% 서열 동일성을 보입니다. 안정적인 PBS/glycerol 버퍼에 보존됩니다.
- 카탈로그번호
- HPA058921-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058921-100 Anti-MAPK8IP1 Antibody, mitogen-activated protein kinase 8 interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058921-25 Anti-MAPK8IP1 Antibody, mitogen-activated protein kinase 8 interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAPK8IP1 Antibody
Anti-MAPK8IP1 Antibody
Target Information
- Target Protein: Mitogen-activated protein kinase 8 interacting protein 1
- Target Gene: MAPK8IP1
- Alternative Gene Names: IB1, JIP-1, JIP1, PRKM8IP
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MAPK8IP1.
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000027223 | 98% |
| Rat | ENSRNOG00000058478 | 98% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



