
Atlas Antibodies Anti-MAPK7 Antibody
상품 한눈에 보기
인간 MAPK7 단백질을 인식하는 토끼 다클론 항체. ERK5/BMK1 단백질 검출에 적합. PrEST 항원으로 친화 정제됨. 인간에 반응하며, 생쥐 및 랫드와 99% 서열 동일성. PBS와 글리세롤 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAPK7 Antibody
Target: mitogen-activated protein kinase 7 (MAPK7)
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human MAPK7, also known as ERK5, BMK1, or PRKM7.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitogen-activated protein kinase 7 |
| Target Gene | MAPK7 |
| Alternative Gene Names | BMK1, ERK5, PRKM7 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (99%), Rat (99%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | PBS (pH 7.2) with 40% glycerol |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAPK8IP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPK8IP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPK7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPK3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPK6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.