
Atlas Antibodies Anti-MAPK6 Antibody
Human MAPK6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 반응성(인간, 마우스, 랫트)을 보입니다. ERK3 등 대체 유전자명으로도 알려진 MAPK6 검출에 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAPK6 Antibody
Target: Mitogen-activated protein kinase 6 (MAPK6)
Type: Rabbit Polyclonal Antibody
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MAPK6, also known as ERK3, HsT17250, p97MAPK, and PRKM6.
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mitogen-activated protein kinase 6 |
| Target Gene | MAPK6 |
| Alternative Gene Names | ERK3, HsT17250, p97MAPK, PRKM6 |
Antigen Information
Antigen Sequence (PrEST):
YSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSH
Species Reactivity
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Human | – | – |
| Mouse | ENSMUSG00000042688 | 96% |
| Rat | ENSRNOG00000009381 | 96% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAPK7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPK3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPK6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPK13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPK1IP1L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|