
Atlas Antibodies Anti-MAGEB6 Antibody
상품 한눈에 보기
Human MAGEB6 단백질을 인식하는 폴리클로날 토끼 항체로, 멜라노마 항원 연구에 적합함. Affinity purification 방식으로 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 추천됨. PBS/glycerol buffer로 안정적 보관 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAGEB6 Antibody
Target: Melanoma antigen family B, 6
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal antibody against human MAGEB6.
Alternative Gene Names
CT3.4, FLJ40242, MAGE-B6, MAGEB6A
Target Information
- Target Protein: Melanoma antigen family B, 6
- Target Gene: MAGEB6
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SVPQESQGASPTGSPDAGVSGSKYDVAANGQDEKSPSTSHDVSVPQESQGASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKK
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000055102 | 30% |
| Mouse | ENSMUSG00000031789 | 29% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAGEB3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEB5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEB6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEB4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.