Atlas Antibodies Anti-MAGEB3 Antibody

상품 한눈에 보기

Human MAGEB3 단백질을 인식하는 rabbit polyclonal 항체로, melanoma antigen family B3 연구용에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 사용 가능. Human에 반응성이 검증됨.

카탈로그번호: HPA072203-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA072203-100 Anti-MAGEB3 Antibody, melanoma antigen family B3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA072203-25 Anti-MAGEB3 Antibody, melanoma antigen family B3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MAGEB3 Antibody

Anti-MAGEB3 Antibody

Target: Melanoma antigen family B3 (MAGEB3)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human MAGEB3 protein, designed for research use.
Alternative gene name: CT3.5

Open Datasheet (PDF)

Recommended Applications

Immunohistochemistry (IHC)

Target Information

Target Protein: Melanoma antigen family B3
Target Gene: MAGEB3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

TRGQTQDHQGAQITATNKKKVSFSSPLILGATIQKKSAGRSRSALKKPQRA

Species Reactivity

Verified Reactivity: Human
Interspecies Information:
- Mouse (ENSMUSG00000020831): 31% identity
- Rat (ENSRNOG00000002468): 30% identity

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand