Atlas Antibodies Anti-MAGEB4 Antibody
Human MAGEB4 단백질을 인식하는 rabbit polyclonal 항체로, IHC orthogonal validation 완료. Affinity purification 방식으로 높은 특이성과 재현성 확보. 인간 시료에 적합하며 RNA-seq 기반 검증 데이터 제공. PBS/glycerol buffer에 보존됨.
- 카탈로그번호
- HPA030456-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-MAGEB4 Antibody
Anti-MAGEB4 Antibody
melanoma antigen family B, 4
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human MAGEB4.
Alternative Gene Names
CT3.6, MGC33144
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | melanoma antigen family B, 4 |
| Target Gene | MAGEB4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000073069 (42%), Rat ENSRNOG00000055102 (36%) |
Antigen Sequence:
KVGQPTAAEKEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIISKKYKEHFPE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.