CacheBy
Atlas Antibodies Anti-MAGEB4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAGEB4 Antibody

상품 한눈에 보기

Human MAGEB4 단백질을 인식하는 rabbit polyclonal 항체로, IHC orthogonal validation 완료. Affinity purification 방식으로 높은 특이성과 재현성 확보. 인간 시료에 적합하며 RNA-seq 기반 검증 데이터 제공. PBS/glycerol buffer에 보존됨.

카탈로그번호
HPA030456-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030456-100 Anti-MAGEB4 Antibody, melanoma antigen family B, 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030456-25 Anti-MAGEB4 Antibody, melanoma antigen family B, 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAGEB4 Antibody

Anti-MAGEB4 Antibody

melanoma antigen family B, 4

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human MAGEB4.

Alternative Gene Names

CT3.6, MGC33144

Open Datasheet

Target Information

항목 내용
Target Protein melanoma antigen family B, 4
Target Gene MAGEB4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000073069 (42%), Rat ENSRNOG00000055102 (36%)

Antigen Sequence:
KVGQPTAAEKEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIISKKYKEHFPE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.