CacheBy
Atlas Antibodies Anti-MAGEB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAGEB2 Antibody

상품 한눈에 보기

인간 MAGEB2 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. 멜라노마 항원 연구에 적합하며, 높은 특이성과 정제된 품질을 제공합니다. PBS/glycerol 버퍼에 보존되어 있으며, 다양한 응용 조건에 최적화 가능합니다.

카탈로그번호
HPA074544-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074544-100 Anti-MAGEB2 Antibody, MAGE family member B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074544-25 Anti-MAGEB2 Antibody, MAGE family member B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAGEB2 Antibody

Anti-MAGEB2 Antibody

Target Information

  • Target Protein: Melanoma antigen family B2
  • Target Gene: MAGEB2
  • Alternative Gene Names: CT3.2, DAM6, MAGE-XP-2, MGC26438

Product Description

Polyclonal antibody against human MAGEB2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000073069 (43%)
  • Rat ENSRNOG00000055102 (40%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

ICC (Immunocytochemistry)

Reference

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.