CacheBy
Thermo Fisher Scientific GSTM1 Polyclonal Antibody
원본

Thermo Fisher Scientific GSTM1 Polyclonal Antibody

상품 한눈에 보기

GSTM1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot, ICC/IF, Flow cytometry에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, PBS 및 트레할로스 완충액에 동결건조 형태로 제공됨. 연구용 전용 제품.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오전 09:37
Thermo Fisher Scientific PA579337 GSTM1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific GSTM1 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunocytochemistry (ICC/IF) 5 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746453

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. Eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta, and zeta.
This gene encodes a glutathione S-transferase belonging to the mu class, which functions in detoxification of electrophilic compounds—including carcinogens, therapeutic drugs, environmental toxins, and oxidative stress products—by conjugation with glutathione.
The mu class genes are clustered on chromosome 1p13.3 and are highly polymorphic, influencing susceptibility to carcinogens and drug responses. Null mutations in this gene are associated with increased cancer risk due to reduced detoxification capacity. Multiple isoforms are encoded by transcript variants.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.