
Thermo Fisher Scientific GSTM1 Polyclonal Antibody
GSTM1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot, ICC/IF, Flow cytometry에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, PBS 및 트레할로스 완충액에 동결건조 형태로 제공됨. 연구용 전용 제품.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746453 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. Eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta, and zeta.
This gene encodes a glutathione S-transferase belonging to the mu class, which functions in detoxification of electrophilic compounds—including carcinogens, therapeutic drugs, environmental toxins, and oxidative stress products—by conjugation with glutathione.
The mu class genes are clustered on chromosome 1p13.3 and are highly polymorphic, influencing susceptibility to carcinogens and drug responses. Null mutations in this gene are associated with increased cancer risk due to reduced detoxification capacity. Multiple isoforms are encoded by transcript variants.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Gelsolin Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GSR Polyclonal Antibody
599,200원

Thermo Fisher Scientific
Thermo Fisher Scientific GSTM1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific GSTA1/A2/A3/A4/A5 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|